PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G212100.1
Common NamePHAVU_008G212100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family TALE
Protein Properties Length: 304aa    MW: 34809.6 Da    PI: 7.1902
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G212100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.71.1e-092332672155
                         HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                         k +yps+++++ LA+++gL+ +q+ +WF N+R ++
  Phvul.008G212100.1 233 KWPYPSESQKQALAESTGLDLKQINNWFINQRKRH 267
                         569*****************************885 PP

2ELK38.52.5e-13187208122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELK qLlrKYsgyLgsLk+EF+
  Phvul.008G212100.1 187 ELKVQLLRKYSGYLGSLKKEFL 208
                         9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.9E-155397IPR005540KNOX1
PfamPF037905.7E-195596IPR005540KNOX1
SMARTSM012561.4E-26106157IPR005541KNOX2
PfamPF037916.2E-22109155IPR005541KNOX2
SMARTSM011887.1E-7187208IPR005539ELK domain
PROSITE profilePS5121311.139187207IPR005539ELK domain
PfamPF037891.8E-9187208IPR005539ELK domain
PROSITE profilePS5007112.228207270IPR001356Homeobox domain
SuperFamilySSF466891.92E-19209281IPR009057Homeodomain-like
SMARTSM003892.8E-12209274IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.2E-28212273IPR009057Homeodomain-like
CDDcd000861.04E-12219271No hitNo description
PfamPF059202.6E-17227266IPR008422Homeobox KN domain
PROSITE patternPS000270245268IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MDMMNMETNR KFLSLPLSNN SGAQMRSDRR VPVATNSIAQ DHHYTHHNPT DTCSVRDKIM  60
AHPLFPRLLS SYLNCLKVGA PPDVVASLEE SCAKCESINA SSGRTGSGSI GEDPALDQFM  120
EAYCEMLIKY EQELTKPFKE AMLFFSRIEC QLKALAVSSD FGQSESSSQN EVDVHENNLD  180
TQAEDRELKV QLLRKYSGYL GSLKKEFLKK KKNGKLPKEA RQQLLDWWNR HYKWPYPSES  240
QKQALAESTG LDLKQINNWF INQRKRHWKP SEDMQFAVMD ATNYYMENVM CKPFPMDGMP  300
MLL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141628.10.0hypothetical protein PHAVU_008G212100g
SwissprotP466081e-120HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLV7B6U20.0V7B6U2_PHAVU; Uncharacterized protein
STRINGGLYMA14G05150.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-104KNOX/ELK homeobox transcription factor